PA-0091

Ashtanga Bridge

Setu Bandhasana (Ashtanga)

AdvancedBackbend FoundationsBackbends

At a glance

The primary series version of Bridge, a considerably more intense variation with the crown of the head resting on the floor and the feet turned out onto their outer edges, lifting the pelvis into a deep backbend. Unlike the general Bridge Pose entry, this version places real, sustained weight through the neck, and it carries a correspondingly higher safety bar.

Build real neck strength before this pose bears weight on it.

Essence

This pose asks the neck to do genuine weight-bearing work, which is a fundamentally different demand than the general Bridge Pose's threading-the-shoulders approach. That difference means this variation isn't simply "Bridge, but more," it's a pose with its own distinct prerequisite: real, tested neck strength.

Intention

To lift into a deep backbend with the crown of the head bearing weight on the floor, building significant neck and back strength together.

What this pose develops

Physical

  • Neck strength under direct load, a rare demand in most practices
  • Deep spinal extension
  • Hip flexor length through the turned-out feet position

Mental

  • Real caution and body awareness given the neck's direct involvement
  • Patience with a pose that depends on strength built specifically for it

Teaching concepts

  • Screening for any neck sensitivity or injury history before ever suggesting this pose
  • Treating the general Bridge Pose as a completely appropriate substitute, not a lesser one

How to practise

  1. 1Lie on the back, feet turning out onto their outer edges, heels close to the hips.
  2. 2Walk the shoulders and head back, bringing the crown of the head to the floor.
  3. 3Press through the feet and begin lifting the pelvis, keeping the neck actively strong rather than passively collapsing.
  4. 4Bring the hands to the heels or lower back for support if available.
  5. 5Hold for five breaths, gaze to the nose, keeping the neck engaged throughout, not just at the start.
  6. 6Release with control, rolling out of the position slowly.

Alignment exploration

Instead of searching for the “correct” position, notice:

  • Neck actively engaged and strong throughout, never passively bearing weight.
  • Feet turned out onto their outer edges, heels close to the hips.
  • Pelvis lifts as high as the neck and back genuinely support, not maximally at any cost.

Breath

Ujjayi breath, though given the intensity of the neck's involvement, breath often becomes secondary to careful, attentive movement.

Teacher’s eye

Screen thoroughly for any neck sensitivity, injury history, or lack of demonstrated neck strength before this pose is ever suggested. This is one of the poses in this library where "use the general Bridge Pose instead" is the right answer for the large majority of students, not a consolation.

Student practice

Reflect after practising:

  • If you have any neck sensitivity or injury history, this specific variation isn't for you today, or possibly ever. The general Bridge Pose gives you a very similar backbend without that same risk.
  • The neck needs to feel actively strong throughout, not like it's passively resting under weight. If that active strength isn't there, come out.

Common movement strategies

Rather than mistakes, you may notice:

  • Build dedicated neck strength through gentle, specific exercises, separate from this pose, before ever attempting it, and always with a qualified teacher's direct guidance.

Modifications

  • Bridge Pose (general version) as a complete and appropriate substitute for the overwhelming majority of students.

Completion check

  • Release with slow control, rolling out of the neck position carefully rather than dropping out of it quickly.

Related poses

Prerequisites

Bridge Pose (general)

Complements

Fish (Ashtanga)

Counterposes

Gentle neck release

Alternatives

Bridge Pose (general)

Regressions

Bridge Pose (general)

Related movement concepts

Direct neck weight-bearing as a distinct, higher-caution categoryReal prerequisite strength, not just flexibilityAppropriate substitution as the correct teaching choice for most students

Search tags

backbendashtangaadvancedprimary-seriesneck-caution

More backbends poses

See all →

This pose is one piece. Sequence/OS is the whole class.

Sequence Ashtanga Bridge into a full arc, teach it hands-free with Play Mode, and build your week of classes in one Sunday sitting.

Try it free for 7 days

$30/month after trial. Cancel any time.