PA-0097

Frog Pose

Bhekasana

AdvancedBackbend FoundationsBackbends

At a glance

An intense prone quadriceps and ankle stretch, bending both knees and rotating the hands to press the feet toward the hips. This pose carries real, specific risk to the knee if the hand rotation and pressing direction aren't set up correctly, and it deserves the same category of caution as the more extreme seated hip poses.

Rotate the hand before you press the foot anywhere.

Essence

The specific rotation of the hand, and the direction the foot is pressed, matter enormously here. Pressing straight down onto the foot without the correct rotation can torque the knee joint in a direction it isn't built to handle, and this is a pose where technique precision isn't optional detail, it's the difference between a safe stretch and an injury.

Intention

To stretch the quadriceps and ankles intensely through a prone position with both knees bent and the feet pressed toward the hips.

What this pose develops

Physical

  • Significant quadriceps length
  • Ankle dorsiflexion range
  • Shoulder rotation through the specific hand position required

Mental

  • Careful, technical attention to a pose where precision genuinely matters for safety
  • Patience with a pose that shouldn't be rushed into

Teaching concepts

  • Teaching the specific hand rotation explicitly and checking it before any pressing begins
  • Treating knee discomfort here as an immediate stop signal, not something to ease into

How to practise

  1. 1Lie on the belly, and bend both knees.
  2. 2Rotate each hand so the fingers point toward the toes, thumb side down, before reaching back for the feet.
  3. 3With the hand correctly rotated, press the feet down and forward, toward the hips.
  4. 4Lift the chest as the feet press down, opening across the front body.
  5. 5Hold for five breaths, gaze to the nose, feeling the stretch in the quadriceps and ankles specifically.
  6. 6Release the feet with care, extending the legs to rest.

Alignment exploration

Instead of searching for the “correct” position, notice:

  • Hand rotation set correctly before any pressing begins, fingers oriented toward the toes.
  • Feet press down and forward, not straight down, which is the detail that protects the knee.
  • Knees stay roughly hip-width, not splaying uncomfortably wide.

Breath

Ujjayi breath, though the intensity of this stretch often shortens it naturally. That's a normal response to a demanding sensation, not a sign of doing it wrong.

Teacher’s eye

The hand rotation is worth confirming before any pressing begins, every time, with every student. This is one of the poses in this library where a single technical detail is the entire difference between a safe stretch and a real risk to the knee joint.

Student practice

Reflect after practising:

  • Any sharp or pinching sensation in the knee means come out immediately. This isn't a pose to breathe through discomfort in.
  • Take the time to find the correct hand rotation before pressing. Rushing this setup is where injuries in this pose tend to happen.

Common movement strategies

Rather than mistakes, you may notice:

  • Practice the hand rotation and foot pressing on one leg at a time first, to build a clear, careful sense of the correct direction before combining both legs.

Modifications

  • One leg at a time instead of both together.
  • A strap around the foot, held with the correctly rotated hand, if reaching the foot directly isn't accessible.
  • A gentler press, not pushing the foot all the way to the hip.

Props

Yoga strap

Completion check

  • Release the feet with care, extending the legs slowly to rest rather than releasing suddenly.

Related poses

Prerequisites

Cobra Pose

Complements

Camel Pose

Counterposes

Child's Pose

Alternatives

One leg at a time

Progressions

Both feet pressed fully to the hips

Regressions

One leg at a time

Related movement concepts

Precise technique as a safety requirement, not a refinementHand rotation direction as the key mechanism protecting the kneeSharp pain as an immediate, non-negotiable stop signal

Search tags

backbendashtangaadvancedprimary-seriesknee-caution

More backbends poses

See all →

This pose is one piece. Sequence/OS is the whole class.

Sequence Frog Pose into a full arc, teach it hands-free with Play Mode, and build your week of classes in one Sunday sitting.

Try it free for 7 days

$30/month after trial. Cancel any time.